CHCHD8 Antibody - middle region : HRP

CHCHD8 Antibody - middle region : HRP
SKU
AVIARP56948_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of CHCHD8 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHCHD8

Molecular Weight: 10kDa

Peptide Sequence: Synthetic peptide located within the following region: SHFAVQECMAQHQDWRQCQPQVQAFKDCMSEQQARRQEELQRRQEQAGAH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Cytochrome c oxidase assembly factor 4 homolog, mitochondrial

Protein Size: 87

Purification: Affinity Purified
More Information
SKU AVIARP56948_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56948_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51287
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×