CHORDC1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CHRD1

Key Reference: N/A

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: TYHPGVPVFHDALKGWSCCKRRTTDFSDFLSIVGCTKGRHNSEKPPEPVK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cysteine and histidine-rich domain-containing protein 1

Protein Size: 332

Purification: Affinity purified

• SKU: AVIARP54843_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54843_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 26973
• Host: Rabbit