CRBN Antibody - N-terminal region : Biotin

CRBN Antibody - N-terminal region : Biotin
SKU
AVIARP56882_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a protein related to the Lon protease protein family. In rodents and other mammals this gene product is found in the cytoplasm localized with a calcium channel membrane protein, and is thought to play a role in brain development. Mutatio

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CRBN

Key Reference: 0

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: DQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein cereblon

Protein Size: 442

Purification: Affinity Purified
More Information
SKU AVIARP56882_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56882_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51185
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×