Uniprot: P25774
Gene Name: CTSS
Immunogen: Recombinant human CTSS
Purity: ≥85%
Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide
Identity-Mouse (%): 81%
Core Sequence: LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 81%, Rat - 81%, Pig - 84%, Cynomolgus monkey - 97%
Alternative gene names: /
Alternative protein names: Cathepsin S
Protein name: Cathepsin S
Clone No.: K29028_14G7
Antigen Species: Human
Target Name: CTSS
IHC Verification: -
IHC Dilution: N/A
WB Verification: succeed
WB Dilution: 1:1000
IP Verification: Fail (HL-60)
IP Dilution: N/A
IF Verification: -
IF Dilution: N/A
Sandwich ELISA Verification: -
Sandwich ELISA Dilution: N/A
Antigen ID: PP-1683
Cross reactivity: Not tested