CTSS Antibody

CTSS Antibody
SKU
ASBKC-1024-50
Packaging Unit
50 μl
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Uniprot: P25774

Gene Name: CTSS

Immunogen: Recombinant human CTSS

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 81%

Core Sequence: LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 81%, Rat - 81%, Pig - 84%, Cynomolgus monkey - 97%

Alternative gene names: /

Alternative protein names: Cathepsin S

Protein name: Cathepsin S

Clone No.: K29028_13F4

Antigen Species: Human

Target Name: CTSS

IHC Verification: -

IHC Dilution: N/A

WB Verification: succeed

WB Dilution: 1:1000

IP Verification: -

IP Dilution: N/A

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: -

Sandwich ELISA Dilution: N/A

Antigen ID: PP-1683

Cross reactivity: Not tested
More Information
SKU ASBKC-1024-50
Manufacturer Absea Biotechnology
Manufacturer SKU KC-1024-50
Package Unit 50 μl
Quantity Unit STK
Reactivity Human
Clonality Monoclonal
Application Western Blotting
Isotype IgG2a
Human Gene ID 1520
Host Mouse
Conjugate Unconjugated
Product information (PDF)
×
MSDS (PDF)
×