Cxxc5 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Cxxc5 may indirectly participate in activation of the NF-kappa-B and MAPK pathways. It acts as a mediator of BMP4-mediated modulation of canonical Wnt signaling activity in neural stem cells. Cxxc5 is also required for DNA damage-induced ATM phosphorylation, p53 activation and cell cycle arrest and is involved in myelopoiesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Cxxc5

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: MSSLGGGSQDAGGSSSSSNTNSSSGSGQKAGGTDKSTAVAATTAPTSVAD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: CXXC-type zinc finger protein 5

Protein Size: 317

Purification: Affinity Purified

• SKU: AVIARP58792_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58792_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 67393
• Host: Rabbit