CYP26B1 Antibody - middle region : FITC

CYP26B1 Antibody - middle region : FITC
SKU
AVIARP57352_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and the synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene is involved in the specific inactivation of all-trans-retinoic acid to hydroxylated forms, such as 4-oxo-, 4-OH-, and 18-OH-all-trans-retinoic acid.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CYP26B1

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: SRFELATRTFPRITLVPVLHPVDGLSVKFFGLDSNQNEILPETEAMLSAT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytochrome P450 26B1

Protein Size: 512

Purification: Affinity Purified
More Information
SKU AVIARP57352_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57352_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 56603
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×