DAGLB Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: DAGLB belongs to the AB hydrolase superfamily.It catalyzes the hydrolysis of diacylglycerol (DAG) to 2-arachidonoyl-glycerol (2-AG), the most abundant endocannabinoid in tissues. This protein is required for axonal growth during development and for retrograde synaptic signaling at mature synapses.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DAGLB

Key Reference: Ma,J., (2007) Atherosclerosis 191 (1), 63-72

Molecular Weight: 74kDa

Peptide Sequence: Synthetic peptide located within the following region: STAELFSTYFSDTDLVPSDIAAGLALLHQQQDNIRNNQEPAQVVCHAPGS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Sn1-specific diacylglycerol lipase beta

Protein Size: 672

Purification: Affinity Purified

• SKU: AVIARP55430_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55430_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 221955
• Host: Rabbit