DBP Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: DBP is a member of the PAR bZIP (proline and acidic amino acid-rich basic leucine zipper) transcription factor family. It is transcriptional activator that recognizes and binds to the sequence 5'-RTTAYGTAAY-3' found in the promoter of genes such as albumin, CYP2A4 and CYP2A5. The protein is not essential for circadian rhythm generation, but modulates important clock output genes.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DBP

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: FSEEELKPQPIMKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: D site-binding protein

Protein Size: 325

Purification: Affinity Purified

• SKU: AVIARP57959_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57959_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 1628
• Host: Rabbit