DDHD2 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: DDHD2 is a phospholipase that hydrolyzes preferentially phosphatidic acid and phosphatidylethanolamine.DDHD2 may be involved in the maintenance of the endoplasmic reticulum and/or Golgi structures.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DDHD2

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: DGWGSTPTEQGRPRTVKRGVENISVDIHCGEPLQIDHLVFVVHGIGPACD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phospholipase DDHD2

Protein Size: 711

Purification: Affinity Purified

• SKU: AVIARP55202_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55202_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23259
• Host: Rabbit