Dennd1a Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Dennd1a is a guanine nucleotide exchange factor (GEF) for RAB35. It may be involved in the clathrin-mediated endocytosis of synaptic vesicles.

Molecular Weight: 111kDa

Peptide Sequence: Synthetic peptide located within the following region: QPLGQAKSLEDLRAPKDLREQPGSFDYQRLDLCRSERGLSMAAALKLAHP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: DENN domain-containing protein 1A

Protein Size: 1016

Purification: Affinity Purified

• SKU: AVIARP57502_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57502_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 227801
• Host: Rabbit