DENND1A Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: DENND1A may be involved in the clathrin-mediated endocytosis of synaptic vesicles.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DENND1A

Molecular Weight: 110kDa

Peptide Sequence: Synthetic peptide located within the following region: PGVSVHLSVHSYFTVPDTRELPSIPENRNLTEYFVAVDVNNMLHLYASML

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DENN domain-containing protein 1A

Protein Size: 1009

Purification: Affinity Purified

• SKU: AVIARP57501_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57501_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57706
• Host: Rabbit