DGKZ Antibody

Uniprot: Q13574-1

Gene Name: DGKZ

Immunogen: Recombinant human DGKZ

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 98%

Core Sequence: STGSKDVVRYLLDHAPPEILDAVEENGETCLHQAAALGQRTICHYIVEAGASLMKTDQQGDTPRQRAEKAQDTELAAYLENRQHYQMIQR

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 98%, Rat - 99%

Alternative gene names: DAGK6

Alternative protein names: diacylglycerol kinase zeta

Protein name: Diacylglycerol kinase zeta

Clone No.: K49027_7B11

Antigen Species: Human

Target Name: DGKZ

IHC Verification: -

IHC Dilution: N/A

WB Verification: succeed

WB Dilution: 1:1000

IP Verification: -

IP Dilution: N/A

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: -

Sandwich ELISA Dilution: N/A

Antigen ID: PP-11994

Cross reactivity: Not tested

• SKU: ASBKC-1025-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: KC-1025-100
• Package Unit: 100 μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine)
• Clonality: Monoclonal
• Application: Western Blotting
• Isotype: IgG1
• Host: Mouse
• Conjugate: Unconjugated