DGKZ Antibody

DGKZ Antibody
SKU
ASBKC-1025-50
Packaging Unit
50 μl
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Uniprot: Q13574-1

Gene Name: DGKZ

Immunogen: Recombinant human DGKZ

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 98%

Core Sequence: STGSKDVVRYLLDHAPPEILDAVEENGETCLHQAAALGQRTICHYIVEAGASLMKTDQQGDTPRQRAEKAQDTELAAYLENRQHYQMIQR

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 98%, Rat - 99%

Alternative gene names: DAGK6

Alternative protein names: diacylglycerol kinase zeta

Protein name: Diacylglycerol kinase zeta

Clone No.: K49027_7B11

Antigen Species: Human

Target Name: DGKZ

IHC Verification: -

IHC Dilution: N/A

WB Verification: succeed

WB Dilution: 1:1000

IP Verification: -

IP Dilution: N/A

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: -

Sandwich ELISA Dilution: N/A

Antigen ID: PP-11994

Cross reactivity: Not tested
More Information
SKU ASBKC-1025-50
Manufacturer Absea Biotechnology
Manufacturer SKU KC-1025-50
Package Unit 50 μl
Quantity Unit STK
Reactivity Human, Mouse (Murine)
Clonality Monoclonal
Application Western Blotting
Isotype IgG1
Host Mouse
Conjugate Unconjugated
Product information (PDF)
×
MSDS (PDF)
×