DNAJB1 Antibody

Uniprot: P25685

Gene Name: DNAJB1

Immunogen: Recombinant human DNAJB1

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 95%

Core Sequence: LARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLK

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 95%, Rat - 56%, Pig - 97%, Cynomolgus monkey - 98%

Alternative gene names: DNAJ1；HDJ1；HSPF1

Alternative protein names: DnaJ homolog subfamily B member 1; DnaJ protein homolog 1; Heat shock 40 kDa protein 1; HSP40; Heat shock protein 40; Human DnaJ protein 1; hDj-1

Protein name: DnaJ heat shock protein family (Hsp40) member B1

Clone No.: K92020_11D1

Antigen Species: Human

Target Name: DNAJB1

IHC Verification: -

IHC Dilution: N/A

WB Verification: succeed

WB Dilution: 1:1000

IP Verification: succeed

IP Dilution: 1:100

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: -

Sandwich ELISA Dilution: N/A

Antigen ID: PP-769

Cross reactivity: Not tested

• SKU: ASBKC-1010-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: KC-1010-100
• Package Unit: 100 μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Monoclonal
• Application: Immunoprecipitation, Western Blotting
• Isotype: IgG1
• Human Gene ID: 3337
• Host: Mouse
• Conjugate: Unconjugated