E2f5 Antibody - C-terminal region : HRP

E2f5 Antibody - C-terminal region : HRP
SKU
AVIARP57966_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: E2f5 is a transcriptional activator that binds to E2F sites, these sites are present in the promoter of many genes whose products are involved in cell proliferation. It may mediate growth factor-initiated signal transduction.

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: QPSSQSSTSVTPQKSTMAAQNLPEQHVSERSQTFQQTPAAEVSSGSISGD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transcription factor E2F5

Protein Size: 335

Purification: Affinity Purified
More Information
SKU AVIARP57966_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57966_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 13559
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×