EEA1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: EEA1 is involved in neuronal synaptic vesicle function and axonal transport and growth. EEA1 may undergo calcium-dependent conformational changes that are required for binding to SNAP-25.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EEA1

Molecular Weight: 162kDa

Peptide Sequence: Synthetic peptide located within the following region: ESSSEGFICPQCMKSLGSADELFKHYEAVHDAGNDSGHGGESNLALKRDD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Early endosome antigen 1

Protein Size: 1411

Purification: Affinity Purified

• SKU: AVIARP58126_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58126_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 8411
• Host: Rabbit