EIF2C1 Antibody - N-terminal region : Biotin

EIF2C1 Antibody - N-terminal region : Biotin
SKU
AVIARP54863_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-me

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EIF2C1

Key Reference: Eulalio,A., (2008) Nat. Struct. Mol. Biol. 15 (4), 346-353

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein argonaute-1

Protein Size: 857

Purification: Affinity Purified
More Information
SKU AVIARP54863_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54863_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26523
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×