EIF4ENIF1 Antibody - N-terminal region : Biotin

EIF4ENIF1 Antibody - N-terminal region : Biotin
SKU
AVIARP57350_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a nucleocytoplasmic shuttle protein for the translation initiation factor eIF4E. This shuttle protein interacts with the importin alpha-beta complex to mediate nuclear import of eIF4E. It is predominantly cytoplasmic; its own nuclear import is regulated by a nuclear localization signal and nuclear export signals. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EIF4ENIF1

Molecular Weight: 108kDa

Peptide Sequence: Synthetic peptide located within the following region: TEEEPEWFSAGPTSQSETIELTGFDDKILEEDHKGRKRTRRRTASVKEGI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Eukaryotic translation initiation factor 4E transporter

Protein Size: 985

Purification: Affinity Purified
More Information
SKU AVIARP57350_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57350_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 56478
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×