ELP2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: ELP2 regulates the ligand-dependent activation of STAT3. ELP2 acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ELP2

Molecular Weight: 92kDa

Peptide Sequence: Synthetic peptide located within the following region: EESGVWLEQVRVGEVGGNTLGFYDCQFNEDGSMIIAHAFHGALHLWKQNT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Elongator complex protein 2

Protein Size: 826

Purification: Affinity Purified

• SKU: AVIARP57179_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57179_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55250
• Host: Rabbit