ENOPH1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: ENOPH1 is a bifunctional enzyme that catalyzes the enolization of 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P) into the intermediate 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate (HK-MTPenyl-1-P), which is then dephosphorylated to form the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ENOPH1

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: TDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Enolase-phosphatase E1

Protein Size: 261

Purification: Affinity Purified

• SKU: AVIARP57530_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57530_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 58478
• Host: Rabbit