EPHA3 Antibody - N-terminal region : Biotin

EPHA3 Antibody - N-terminal region : Biotin
SKU
AVIARP58618_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene encodes a protein that binds ephrin-A ligands. Two alternatively spliced transcript variants have been described for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human EPHA3

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: SVLDSFGELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDEHYT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ephrin type-A receptor 3

Protein Size: 539

Purification: Affinity Purified
More Information
SKU AVIARP58618_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58618_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2042
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×