EPN2 Antibody - middle region : Biotin

EPN2 Antibody - middle region : Biotin
SKU
AVIARP55479_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This protein interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. It is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis.This gene encodes a protein which interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. The protein is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EPN2

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: SHSEQEYGKAGGSPASYHGSTSPRVSSELEQARPQTSGEEELQLQLALAM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Epsin 2 EMBL AAH93974.1

Protein Size: 584

Purification: Affinity Purified
More Information
SKU AVIARP55479_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55479_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 22905
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×