EPS8 Antibody - C-terminal region : FITC

EPS8 Antibody - C-terminal region : FITC
SKU
AVIARP54727_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the EPS8 family. This protein contains one PH domain and one SH3 domain. It functions as part of the EGFR pathway, though its exact role has not been determined. Highly similar proteins in other organisms are involved in the transduction of signals from Ras to Rac and growth factor-mediated actin remodeling. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of mouse EPS8

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: VFNQITVQKAALEDSNGSSELQEIMRRRQEKISAAASDSGVESFDEGSSH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: epidermal growth factor receptor kinase substrate 8

Protein Size: 561

Purification: Affinity Purified
More Information
SKU AVIARP54727_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54727_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2059
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×