ERVFRD-1 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Many different human endogenous retrovirus (HERV) families are expressed in normal placental tissue at high levels, suggesting that HERVs are functionally important in reproduction. This gene is part of a human endogenous retrovirus provirus on chromosome 6 that has inactivating mutations in the gag and pol genes. This gene is the envelope glycoprotein gene which appears to have been selectively preserved. The gene's protein product plays a major role in placental development and trophoblast fusion. The protein has the characteristics of a typical retroviral envelope protein, including a cleavage site that separates the surface (SU) and transmembrane (TM) proteins which form a heterodimer.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ERVFRD-1

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: PLVSLLLLLLFGPCLLNLITQFVSSRLQAIKLQTNLSAGRHPRNIQESPF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: HERV-FRD_6p24.1 provirus ancestral Env polyprotein

Protein Size: 538

Purification: Affinity Purified

• SKU: AVIARP56009_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56009_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 405754
• Host: Rabbit