EVX1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: EVX1 is a member of the even-skipped homeobox family characterized by the presence of a homeodomain closely related to the Drosophila even-skipped (eve) segmentation gene of the pair-rule class. The protein may play an important role as a transcriptional repressor during embryogenesis.This gene encodes a member of the even-skipped homeobox family characterized by the presence of a homeodomain closely related to the Drosophila even-skipped (eve) segmentation gene of the pair-rule class. The encoded protein may play an important role as a transcriptional repressor during embryogenesis. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-343 AC004080.2 115915-116257 344-1717 X60655.1 86-1459 1718-1858 AC004080.2 119803-119943

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EVX1

Key Reference: Briata,P., (1995) J. Biol. Chem. 270 (46), 27695-27701

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: PEPPEKMVPRGCLSPRAVPPATRERGGGGPEEEPVDGLAGSAAGPGAEPQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Homeobox even-skipped homolog protein 1

Protein Size: 407

Purification: Affinity Purified

• SKU: AVIARP57971_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57971_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2128
• Host: Rabbit