EYA3 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may act as a transcriptional activator and have a role during development. A similar protein in mice acts as a transcriptional activator.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human EYA3

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: YQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTPSKDTDDQSRKNMTSKN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Eyes absent homolog 3

Protein Size: 447

Purification: Affinity Purified

• SKU: AVIARP57974_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57974_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2140
• Host: Rabbit