Fam168a Antibody - N-terminal region : Biotin

Fam168a Antibody - N-terminal region : Biotin
SKU
AVIARP55188_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: NSPSYAPATLLMKQAWPQNSSSCGTEGTFHLPVDTGTENRTYQASSAAFR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Family with sequence similarity 168, member A EMBL AAH79886.1

Protein Size: 235

Purification: Affinity Purified
More Information
SKU AVIARP55188_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55188_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 319604
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×