FAM50B Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The exact function of FAM50B remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM50B

Key Reference: Sedlacek,Z., (1999) Genomics 61 (2), 125-132

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: EQRRERKRKISCLSFALDDLDDQADAAEARRAGNLGKNPDVDTSFLPDRD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM50B

Protein Size: 325

Purification: Affinity Purified

• SKU: AVIARP54850_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54850_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 26240
• Host: Rabbit