FAM90A1 Antibody - N-terminal region : HRP

FAM90A1 Antibody - N-terminal region : HRP
SKU
AVIARP57109_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: FAM90A1 belongs to subfamily I of the primate-specific FAM90A gene family, which originated from multiple duplications and rearrangements (Bosch et al., 2007 [PubMed 17684299]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM90A1

Key Reference: 0

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: PDEEDPRLKCKNCEAFGHTARSTRCPMKCWKAALVPPNFGEKEGKENLKP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein FAM90A1

Protein Size: 464

Purification: Affinity Purified
More Information
SKU AVIARP57109_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57109_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55138
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×