FAM92B Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM92B

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: FAEDLAKVQDYRQAQVERLETKVVNPLKLYGAQIKQTRAEIKKFKHVQNH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM92B

Protein Size: 304

Purification: Affinity Purified

• SKU: AVIARP55881_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55881_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 339145
• Host: Rabbit