FASTKD2 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein that is localized in the mitochondrial inner compartment and that may play a role in mitochondrial apoptosis. Nonsense mutations have been reported to result in cytochrome c oxidase deficiency.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FASTKD2

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: DTNRNQVLPLSDVDTTSATDIQRVAVLCVSRSAYCLGSSHPRGFLAMKMR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: FAST kinase domain-containing protein 2

Protein Size: 710

Purification: Affinity Purified

• SKU: AVIARP55108_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55108_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 22868
• Host: Rabbit