FBXL4 Antibody - N-terminal region : FITC

FBXL4 Antibody - N-terminal region : FITC
SKU
AVIARP54856_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains at least 9 tandem leucine-rich repeats.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FBXL4

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: VLETYHPGAVIRILACSANPYSPNPPAEVRWEILWSERPTKVNASQARQF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: F-box/LRR-repeat protein 4

Protein Size: 621

Purification: Affinity Purified
More Information
SKU AVIARP54856_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54856_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26235
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×