Fbxo22 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: HFIKDSKNLTLERHQLTEVGLLDNPELRVVLVFGYNCCKVGASNYLHRVV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: F-box only protein 22 Ensembl ENSMUSP00000117106

Protein Size: 299

Purification: Affinity Purified

• SKU: AVIARP54859_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54859_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 71999
• Host: Rabbit