Fem1c Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Fem1c

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: LHKQTASDLLDEKEIAKNLIQPINHTTLQCLAARVIVNHRIYYKGNIPEK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Fem-1 homolog c (C.elegans) (Predicted) EMBL EDM14387.1

Protein Size: 617

Purification: Affinity Purified

• SKU: AVIARP57364_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57364_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 302288
• Host: Rabbit