FGF2 Antibody

FGF2 Antibody
SKU
ASBKC-071-100
Packaging Unit
100 μl
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Uniprot: P09038

Gene Name: FGF2

Immunogen: Recombinant human FGF2

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 97%

Core Sequence: PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 99%

Alternative gene names: FGFB

Alternative protein names: Fibroblast growth factor 2; FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2

Protein name: Fibroblast growth factor 2

Product panel: Cytokines,Neuroscience Biomarkers

Clone No.: KT49

Antigen Species: Human

Target Name: FGF2

IHC Verification: succeed

IHC Dilution: 1:500

WB Verification: succeed

WB Dilution: 1:1000

IP Verification: succeed

IP Dilution: 1:100

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: -

Sandwich ELISA Dilution: N/A

Antigen ID: PP-3005

Cross reactivity: Not tested
More Information
SKU ASBKC-071-100
Manufacturer Absea Biotechnology
Manufacturer SKU KC-071-100
Package Unit 100 μl
Quantity Unit STK
Reactivity Human
Clonality Monoclonal
Application Immunoprecipitation, Western Blotting, Immunohistochemistry, Immunocytochemistry
Isotype IgG1
Human Gene ID 2247
Host Mouse
Conjugate Unconjugated
Product information (PDF)
×
MSDS (PDF)
×