Uniprot: P09038
Gene Name: FGF2
Immunogen: Recombinant human FGF2
Purity: ≥85%
Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide
Identity-Mouse (%): 97%
Core Sequence: PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 99%
Alternative gene names: FGFB
Alternative protein names: Fibroblast growth factor 2; FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2
Protein name: Fibroblast growth factor 2
Product panel: Cytokines,Neuroscience Biomarkers
Clone No.: KT49
Antigen Species: Human
Target Name: FGF2
IHC Verification: succeed
IHC Dilution: 1:500
WB Verification: succeed
WB Dilution: 1:1000
IP Verification: succeed
IP Dilution: 1:100
IF Verification: -
IF Dilution: N/A
Sandwich ELISA Verification: -
Sandwich ELISA Dilution: N/A
Antigen ID: PP-3005
Cross reactivity: Not tested