FKBP5 Antibody - middle region : Biotin

FKBP5 Antibody - middle region : Biotin
SKU
AVIARP54712_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein. This gene has been found to have multiple polyadenylation sites.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human FKBP5

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: KMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peptidyl-prolyl cis-trans isomerase FKBP5

Protein Size: 457

Purification: Affinity Purified
More Information
SKU AVIARP54712_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54712_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2289
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×