FOXL1 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The exact function of FOXL1 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FOXL1

Key Reference: Hassel,S., (2004) Proteomics 4 (5), 1346-1358

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: EDAGDAAQGAAAVAVGQAARTGDGPGSPLRPASRSSPKSSDKSKSFSIDS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Forkhead box protein L1

Protein Size: 345

Purification: Affinity Purified

• SKU: AVIARP57981_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57981_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Pig (Porcine), Dog (Canine), Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2300
• Host: Rabbit