Frg1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Frg1 may have a role in processing of pre-rRNA or in the assembly of rRNA into ribosomal subunits and also may be involved in pre-mRNA splicing

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: GINSDGLVVGRSDAIGPREQWEPVFQDGKMALLASNSCFIRCNEAGDIEA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FRG1

Protein Size: 258

Purification: Affinity Purified

• SKU: AVIARP54731_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54731_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 14300
• Host: Rabbit