FTSJD2 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: FTSJD2 is a S-adenosyl-L-methionine-dependent methyltransferase that mediates mRNA cap1 2'-O-ribose methylation to the 5'-cap structure of mRNAs. It methylates the ribose of the first nucleotide of a m7GpppG-capped mRNA to produce m7GpppNmp (cap1). Cap1 modification is linked to higher levels of translation. It may be involved in the interferon response pathway.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FTSJD2

Molecular Weight: 95kDa

Peptide Sequence: Synthetic peptide located within the following region: YRLEEMEKIFVRLEMKIIKGSSGTPKLSYTGRDDRHFVPMGLYIVRTVNE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1

Protein Size: 835

Purification: Affinity Purified

• SKU: AVIARP55152_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55152_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23070
• Host: Rabbit