GABARAPL1 Antibody - middle region : FITC

GABARAPL1 Antibody - middle region : FITC
SKU
AVIARP58901_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GABARAPL1 is a Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. it is involved in formation of autophagosomal vacuoles. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human GABARAPL1

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: VIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Gamma-aminobutyric acid receptor-associated protein-like 1

Protein Size: 146

Purification: Affinity Purified
More Information
SKU AVIARP58901_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58901_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23710
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×