GARS Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GARS catalyzes the attachment of glycine to tRNA(Gly). Is also able produce diadenosine tetraphosphate (Ap4A), a universal pleiotropic signaling molecule needed for cell regulation pathways, by direct condensation of 2 ATPs.This gene encodes glycyl-tRNA synthetase, one of the aminoacyl-tRNA synthetases that charge tRNAs with their cognate amino acids. The encoded enzyme is an (alpha)2 dimer which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GARS

Key Reference: Forster,C., (2008) Biochem. Biophys. Res. Commun. 368 (4), 1002-1006

Molecular Weight: 83kDa

Peptide Sequence: Synthetic peptide located within the following region: IEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glycine--tRNA ligase

Protein Size: 739

Purification: Affinity Purified

• SKU: AVIARP58758_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58758_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2617
• Host: Rabbit