GBA3 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: GBA3, or cytosolic beta-glucosidase (EC 3.2.1.21), is a predominantly liver enzyme that efficiently hydrolyzes beta-D-glucoside and beta-D-galactoside, but not any known physiologic beta-glycoside, suggesting that it may be involved in detoxification of plant glycosides (de Graaf et al., 2001 [PubMed 11389701]). GBA3 also has significant neutral glycosylceramidase activity (EC 3.2.1.62), suggesting that it may be involved in a nonlysosomal catabolic pathway of glucosylceramide metabolism (Hayashi et al., 2007 [PubMed 17595169]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GBA3

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: LTHYRFSLSWSRLLPDGTTGFINQKGIDYYNKIIDDLLKNGVTPIVTLYH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytosolic beta-glucosidase

Protein Size: 469

Purification: Affinity Purified

• SKU: AVIARP57505_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57505_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57733
• Host: Rabbit