GBP2 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: GBPs are characterized by their ability to specifically bind guanine nucleotides (GMP, GDP, and GTP). GBP2 is a GTPase that converts GTP to GDP and GMP.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GBP2

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: HYVTELTDRIKANSSPGNNSVDDSADFVSFFPAFVWTLRDFTLELEVDGE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interferon-induced guanylate-binding protein 2

Protein Size: 591

Purification: Affinity Purified

• SKU: AVIARP54715_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54715_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2634
• Host: Rabbit