GIMAP2 Antibody - middle region : FITC

GIMAP2 Antibody - middle region : FITC
SKU
AVIARP56177_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human GIMAP2

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: LVTQLGRYTSQDQQAAQRVKEIFGEDAMGHTIVLFTHKEDLNGGSLMDYM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GTPase IMAP family member 2

Protein Size: 337

Purification: Affinity Purified
More Information
SKU AVIARP56177_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56177_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26157
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×