Uniprot: Q9NS71
Gene Name: GKN1
Immunogen: Recombinant human GKN1
Purity: ≥85%
Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide
Identity-Mouse (%): 72%
Core Sequence: SVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSV
Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 72%, Rat - 28%, Pig - 79%, Cynomolgus monkey - 93%
Alternative gene names: AMP18；CA11
Alternative protein names: Gastrokine-1; 18 kDa antrum mucosa protein; AMP-18; Protein CA11
Protein name: Gastrokine 1
Product panel: Cytokines
Clone No.: K40038_11H2
Antigen Species: Human
Target Name: GKN1
IHC Verification: succeed
IHC Dilution: 1:100~1:200
WB Verification: succeed
WB Dilution: 1:1000
IP Verification: -
IP Dilution: N/A
IF Verification: -
IF Dilution: N/A
Sandwich ELISA Verification: -
Sandwich ELISA Dilution: N/A
Antigen ID: PP-403
Cross reactivity: Not tested
English
Deutsch
