GNA15 Antibody - N-terminal region : Biotin

GNA15 Antibody - N-terminal region : Biotin
SKU
AVIARP58472_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: GNA15 belongs to the G-alpha family. Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNA15

Key Reference: Johansson,B.B., (2005) FEBS J. 272 (20), 5365-5377

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: ARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide-binding protein subunit alpha-15

Protein Size: 374

Purification: Affinity Purified

Subunit: alpha-15
More Information
SKU AVIARP58472_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58472_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2769
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×