GNAI2 Antibody - middle region : HRP

GNAI2 Antibody - middle region : HRP
SKU
AVIARP54631_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(i) proteins are involved in hormonal regulation of adenylate cyclase: they inhibit the cyclase in response to beta-adrenergic stimuli.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GNAI2

Key Reference: Sullivan,K.A., J. Cell. Sci. 120 (PT 13), 2171-2178 (2007)

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: EYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Guanine nucleotide-binding protein G(i) subunit alpha-2

Protein Size: 354

Purification: Affinity Purified

Subunit: alpha-2
More Information
SKU AVIARP54631_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54631_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2771
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×