GNAO1 Antibody - N-terminal region : HRP

GNAO1 Antibody - N-terminal region : HRP
SKU
AVIARP55424_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Activated Goalpha interacted directly with PLZF, and enhanced its function as a transcriptional and cell growth suppressor. Goalpha might play a role in mediating extracellular signal-regulated kinase activation by G protein-coupled receptors in the brain

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNAO1

Key Reference: Won,J.H., (2008) Cell. Signal. 20 (5), 884-891

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: PVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Guanine nucleotide-binding protein G(o) subunit alpha

Protein Size: 354

Purification: Affinity Purified

Subunit: alpha
More Information
SKU AVIARP55424_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55424_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2775
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×